PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05595.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 384aa    MW: 42458.8 Da    PI: 6.6513
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05595.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.32.1e-054381340
                      zf-B_box 13 elqlfCedCqqllCedClleeHkg.......Htvv 40
                                  +++++C +++ +lC+ C  + H+        H+v+
  Zmw_sc05595.1.g00020.1.sm.mk  4 RARWHCPEDDAFLCQACDAAVHSAnplarrhHRVR 38
                                  5899******************6689999977765 PP

2CCT66.57.3e-23301344144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Zmw_sc05595.1.g00020.1.sm.mk 301 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 344
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000213.13E-7139No hitNo description
PfamPF062038.5E-18301343IPR010402CCT domain
PROSITE profilePS5101715.993301343IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MRRRARWHCP EDDAFLCQAC DAAVHSANPL ARRHHRVRLL TASSSSSSPR CDPDAPAWLH  60
GLKRGPRTPR SKPGSKHEAA SAAIPAAASA AVPDLEAEDS GSGIVGDTYI EHGLLDDDDD  120
EDILYLVPEF DPMLAELYNP MDDEGEEQKP VCLISTETSP EFASGSADAK GLSAFDVPDM  180
ELASFAADME SLLMGVEEGF DHPGFLSEQK PQVNVDFGSD LEVTATPAPE REDKKRKRPQ  240
MILKLDYEGV IASWAREGGS PWFHGERRPH LDPNDSWPDF SAGIVRGGLV CNVTAVTGGE  300
REARVSRYRE KRRTRLFAKK IRYEVRKLNA EKRPRMKGRF VKRTALPPLP RPPQPSQQQK  360
PQRAPPPTGM VLAPQVGVHG HLRF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311327RRTRLFAKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982006.11e-180PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLK4AAN01e-180K4AAN0_SETIT; Uncharacterized protein
STRINGSi035937m1e-180(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100042228